PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan017351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family HB-other
Protein Properties Length: 438aa    MW: 48886.5 Da    PI: 6.6403
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-14116PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.52e-17660357
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               kR   t+ ql++Le+ ++ ++ ps+e r eL+k+lgL+++q ++WF+NrR k+kk
  Aan017351  6 KRKMKTAFQLRVLEKTYAGEQWPSEELRGELSKQLGLSDQQLRMWFCNRRLKDKK 60
               78999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.58161IPR001356Homeobox domain
SMARTSM003899.8E-16365IPR001356Homeobox domain
SuperFamilySSF466891.28E-15566IPR009057Homeodomain-like
PfamPF000463.8E-15660IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-15660IPR009057Homeodomain-like
CDDcd000869.77E-14662No hitNo description
PfamPF056412.0E-11118189IPR008395Agenet-like domain
SMARTSM007434.2E-9212274IPR014002Agenet domain, plant type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MDGGVKRKMK TAFQLRVLEK TYAGEQWPSE ELRGELSKQL GLSDQQLRMW FCNRRLKDKK  60
TQPEMRSKKV ISSRRRGVGE GLGGNEVGAS VGSGSGSSLF GHGERGVEKG GGLNLKVGQL  120
AEMKTFEEGF RGAWFRCKVN DIDLKKNKIK LEYYDFEEEI SWTKIYEFPP HARKPSLKKK  180
QLMLRPQYPL KYHKSELPPV NSISEICVVI DGVWKVGDMV DWYKDDCYWS ARIIKVLSKD  240
KVQLQLPMPP AGEGSDEILI AFCKDLRPSL DWSQRKGWTL PTVDGQAAAG AQLIFPSKRG  300
MTSQREEVEH TAAAGGDSPL NASSTTGTGI GISVNSSAER QISEPMDTAV FEDVKTDDMV  360
ESTDSISSMR VEESKSAAAA AAEEDVDYSV DLNIMHEETL EAPILDLEEL ANKIKWMKSI  420
LHGHRPPNND GTCWKFSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15259NRRLKDKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.187470.0leaf| trichome
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A118JRU41e-108A0A118JRU4_CYNCS; Agenet-like domain-containing protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.26e-18Homeodomain-like transcriptional regulator